Low StockThe only FDA-approved GHRH analogue — a 44-amino-acid peptide that stimulates pituitary growth hormone release in physiologic pulses rather than constant exogenous elevation.
This preserves feedback loops while increasing GH output.
Clinical trials demonstrated visceral fat reduction with preservation of lean mass.
FDA-approved GHRH analog (Egrifta) for HIV lipodystrophy; multiple RCTs in visceral fat reduction, NAFLD, and cognitive function
This content summarizes published research for educational purposes. It is not medical advice.
Research summary based on 9 peer-reviewed sources•Last updated: February 10, 2026•View references ↓
Tesamorelin is the only FDA-approved growth hormone-releasing hormone (GHRH) analog — a 44-amino-acid peptide that stimulates pituitary growth hormone release in physiologic pulses rather than delivering constant exogenous GH levels. This preserves the body's feedback loops while elevating GH output.
The distinction matters: exogenous growth hormone suppresses natural production and delivers constant, non-pulsatile levels. Tesamorelin stimulates endogenous secretion, maintaining physiologic pulse patterns clustered at night and modulated by sleep, nutrition, and training status. Compared with exogenous GH, tesamorelin produces a more selective, visceral-fat-biased recomposition signal with less edema and glycemic disruption in trials.
Tesamorelin received FDA approval in 2010 following Phase 3 trials in HIV-infected patients with abdominal fat accumulation. Tesamorelin 2 mg daily for 26 weeks produced 15–20% visceral adipose tissue (VAT) reduction versus placebo, with minimal changes in subcutaneous fat. Improvements in triglycerides and waist circumference accompanied the VAT reduction. No major deterioration in fasting glucose or HbA1c over the trial window. This established tesamorelin as a selective visceral-fat-directed agent.1
52-week extension data showed VAT and triglyceride benefits sustained over a full year in those who remained on therapy. Safety profile over 52 weeks remained acceptable, with IGF-1 elevation but no red-flag signal for malignancy or catastrophic glycemic deterioration.2
In people with HIV and MRI-defined non-alcoholic fatty liver disease (NAFLD), tesamorelin reduced hepatic fat fraction and improved histologic features on biopsy — reduced steatosis and slowed fibrosis progression. Benefits were most pronounced in those with higher baseline liver fat. This reframes tesamorelin as more than cosmetic fat redistribution; it shows potential as a liver-disease-modifying therapy in high-risk metabolic contexts.4
Studies in abdominally obese adults with relative GH deficiency showed improved visceral adiposity and cardiometabolic markers. A PLOS One 2017 trial in patients with established type 2 diabetes showed no major worsening in HbA1c or fasting glucose despite expected IGF-1 rises. This suggests GH-axis stimulation with tesamorelin is not automatically disqualifying in dysglycemic states, provided there is careful monitoring.5
In controlled trials, tesamorelin has been associated with preservation or modest increases in lean tissue mass alongside visceral fat reduction. DXA and whole-body MRI analyses show preferential mobilization of visceral fat relative to subcutaneous depots — consistent with differential GH receptor expression between fat compartments.1
Phase 2 trials have investigated tesamorelin in adults with mild cognitive impairment (MCI). Observations included modulation of brain GABA levels and cognitive performance endpoints. The proposed mechanism involves IGF-1 signaling in hippocampal and cortical regions, where IGF-1 receptors influence synaptic plasticity. These findings are preliminary and require larger confirmatory studies.
Tesamorelin requires intact pituitary function — it cannot stimulate GH release if somatotroph capacity is impaired. FDA approval is specifically for HIV-associated lipodystrophy; all other uses (recomposition, NAFLD without HIV, general anti-aging) are off-label extrapolations from the evidence base. GH axis stimulation can modulate insulin sensitivity in susceptible individuals, requiring glucose monitoring. Active malignancy or high neoplasm risk remain relative or absolute contraindications. IGF-1 should be monitored and kept within physiologic high-normal range rather than pushed to acromegalic levels.
For laboratory research use only.
| Amino Acid Sequence | Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 |
|---|---|
| Single-Letter Code | X-YADAIFTNSSYRKVLGQLSARKLLQDIMSR QQGESNQERGARARLNH2 |
| Molecular Formula | C223H370N72O69S |
| Molecular Weight | 5195.91 g/mol |
| Amino Acid Count | 44 |
| CAS Number | 901758-09-6 |
| PubChem CID | 44147413 |
| Origin | Synthetic stabilized analog of growth hormone-releasing hormone (GHRH) with an N-terminal trans-3-hexanoic acid modification for enhanced enzymatic stability |
| Synonyms | Egrifta, TH9507 |